PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa19g040130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 423aa    MW: 47680.9 Da    PI: 5.8503
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa19g040130.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS443.71.3e-135624224374
            GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                     +L++cA+avs+++l la++++ +l+ ++s +g p+qRl ay++e+L arla s+s++yk+l+++e +   s e l+++ +++ev+P++kf+++ a
  Csa19g040130.1  62 VLVACAKAVSENNLLLARWCMGELRGMVSISGAPIQRLGAYMLEGLVARLAASGSSIYKSLQSREPE---SYEFLSYVYVLHEVCPYFKFGYMSA 153
                     79****************************************************************9...9************************ PP

            GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                     N aI ea++ eer+HiiDf+i+qG QW++L+qa+a+Rp+g+p++RiTg+g+        l ++++rL+k+A++++v+f+fn+ +++   ++e+ +
  Csa19g040130.1 154 NGAIAEAMKDEERIHIIDFQIGQGSQWISLIQAFAARPGGAPNIRITGIGD-----VSVLVTVKRRLEKLARKFDVSFKFNA-ISRPSYEVEVAN 242
                     ***************************************************.....89************************.799********* PP

            GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                     L+v++gEal Vn++++lh+l+desvs+e++rd++L++vkslsPkvv++veqe+++n+++Fl rf+e+l+yy+a+f+s+++ lpr+++eri++E++
  Csa19g040130.1 243 LDVREGEALGVNFAYMLHHLPDESVSMENHRDRLLRMVKSLSPKVVTLVEQECNTNTSPFLPRFFETLSYYTAMFESIDVMLPRNHKERISIEQH 337
                     *********************************************************************************************** PP

            GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +l+r++vn++acegaer+erhe l+kW++r+++aGF+p+pls+ + +++++llr ++ +gy +ee++g+l+lgW+dr Lvs +aW+
  Csa19g040130.1 338 CLARDVVNIIACEGAERIERHELLGKWKSRFSMAGFEPYPLSSIISATIRALLRDYS-NGYGIEEKDGALYLGWMDRILVSSCAWK 422
                     ********************************************************9.9**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.07833403IPR005202Transcription factor GRAS
PfamPF035144.4E-13362422IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MDNVRGSRHN VREVETIMLQ PLPEIAESID DVICHELSMW PEDANDLLLI VEAISRGDLK  60
WVLVACAKAV SENNLLLARW CMGELRGMVS ISGAPIQRLG AYMLEGLVAR LAASGSSIYK  120
SLQSREPESY EFLSYVYVLH EVCPYFKFGY MSANGAIAEA MKDEERIHII DFQIGQGSQW  180
ISLIQAFAAR PGGAPNIRIT GIGDVSVLVT VKRRLEKLAR KFDVSFKFNA ISRPSYEVEV  240
ANLDVREGEA LGVNFAYMLH HLPDESVSME NHRDRLLRMV KSLSPKVVTL VEQECNTNTS  300
PFLPRFFETL SYYTAMFESI DVMLPRNHKE RISIEQHCLA RDVVNIIACE GAERIERHEL  360
LGKWKSRFSM AGFEPYPLSS IISATIRALL RDYSNGYGIE EKDGALYLGW MDRILVSSCA  420
WK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-62634228375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0069550.0AC006955.6 Arabidopsis thaliana chromosome 2 clone F28I8 map RNS1, complete sequence.
GenBankAC0072110.0AC007211.6 Arabidopsis thaliana chromosome 2 BAC F1O13 genomic sequence, complete sequence.
GenBankAF2107320.0AF210732.1 Arabidopsis thaliana scarecrow-like 21 (SCL21) mRNA, complete cds.
GenBankAK1752100.0AK175210.1 Arabidopsis thaliana mRNA for putative SCARECROW gene regulator, complete cds, clone: RAFL21-63-H23.
GenBankBT0264550.0BT026455.1 Arabidopsis thaliana At2g04890 mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010488734.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ9S7H50.0SCL21_ARATH; Scarecrow-like protein 21
TrEMBLD7L8K00.0D7L8K0_ARALL; Putative uncharacterized protein
STRINGscaffold_303269.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.10.0SCARECROW-like 21